PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 294aa    MW: 33439.1 Da    PI: 6.7827
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625026.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.6e-5381321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + 
  XP_009625026.1   8 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWDLPGLALYGEKEWYFFSPRDRKYPNGSRPNRAAGNGYWKATGADKPIGN- 100
                     79**************************99.88***************6555679*************************************98. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + vg+kk Lvfy+g+apkgekt+W+mheyrl
  XP_009625026.1 101 -PKPVGIKKALVFYSGKAPKGEKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-633159IPR003441NAC domain
PROSITE profilePS5100560.8998159IPR003441NAC domain
PfamPF023659.2E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAAVELQLPP GFRFHPTDEE LVMHYLCRKC ASQPIAVPII AEIDLYKYDP WDLPGLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGNGYWK ATGADKPIGN PKPVGIKKAL VFYSGKAPKG  120
EKTNWIMHEY RLAHVDRSAR NKNNSLRLDD WVLCRIYNKK GTMEKTQLNS RKMNVGMSPP  180
SSEVDVKPEI LPLPISISTT PSQVYSDFMY LDSSDSLPKL HTDSSCSEHV LSPEREVQSE  240
PKLSDWEKTA VDLQFNYMDA TPDVGDNSLL GSQFLGCYEM SPLQDIFMYL QKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-8321659174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625026.10.0PREDICTED: NAC domain-containing protein 2-like
RefseqXP_016497740.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-139NAC2_ARATH; NAC domain-containing protein 2
TrEMBLM1AJ571e-174M1AJ57_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000239171e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-140NAC family protein